A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10202
Swiss-prot Accession number	Q8HY84 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Cervus nippon (Sika deer)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Cervidae; Cervinae; Cervus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14551
References	1   Guan H.-B., Li Q.-Z., Zhang L.; "Nucleotide sequence of cloned cDNA for beta subunit of Cervus nipponfollicle stimulating hormone."; Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases. 2   Guan H.-B., Li Q.-Z., Zhang L.; "Nucleotide sequence of cloned cDNA for beta subunit of Cervus nipponfollicle stimulating hormone."; Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	RSCELTNITITVEKEECSFCISINTTWCAGYCYTRDLVYRDPARPNIQKTCTFKELVYETVRVPGCAHRADSLHTYPVATACHCGKCDSGSTDCTVRGLGPSYCSFSDIRE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10987
Swiss-prot Accession number	Q8WMR3 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Cervus nippon (Sika deer)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Cervidae; Cervinae; Cervus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	120 Amino acids
Molecular weight	13618
References	1   Li Q., Guan H., Zhang L.; "Nucleotide sequence of cloned cDNA for a subunit of Cervus nipponfollicle stimulating hormone."; Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases. 2   Li Q., Guan H., Zhang L.; "Nucleotide sequence of cloned cDNA for a subunit of Cervus nipponfollicle stimulating hormone."; Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPDGEFMMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTDCHCSTCYYHKS
Position of mature hormone in Pre-Hormone protein	96 Residues from position (25-120)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated